PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000005.1.g00048.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family FAR1
Protein Properties Length: 940aa    MW: 106103 Da    PI: 6.4816
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000005.1.g00048.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR176.74.6e-24227312288
                            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtk 80 
                                     +Yn+YAk vGF+vrk+  ++sk +g++++r+f+Cskeg+r+++k+  ++ +++r+etrtgC a++ ++++ dgk++v++
  FANhyb_rscf00000005.1.g00048.1 227 CYNKYAKLVGFNVRKDWVNRSKVHGQVVSRKFTCSKEGYRRRDKRV-VNVKKHRKETRTGCLAHMIITRQPDGKYRVSH 304
                                     7*****************************************9988.999***************************** PP

                            FAR1  81 leleHnHe 88 
                                     +e++HnHe
  FANhyb_rscf00000005.1.g00048.1 305 IEEQHNHE 312
                                     *******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF476998.25E-113598IPR016140Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain
SMARTSM004992.2E-73897IPR016140Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain
CDDcd046603.23E-113897No hitNo description
PfamPF031011.7E-21227312IPR004330FAR1 DNA binding domain
PfamPF105512.9E-25439533IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 940 aa     Download sequence    Send to blast
MANFKSMISF QTAALLLVVM IGLALVENQI AEAQGGSCMA DLTHLNVCAP FVLPGSDNKP  60
SSDCCSAIQA METTCLCNTL RIAAQIPTQC NLPPLSCGIG NRNPNRTVKA WTLKHTLNLK  120
GGVFTQLNAI CPIGFAHFSR RVCVYRVVQG SMEREEGDLI SIIDETIDFG VETNNSLDLN  180
VEQDCTNSQI VHENGTLSNI SSTNDHSIDA VVKVGTEFES DEHAYSCYNK YAKLVGFNVR  240
KDWVNRSKVH GQVVSRKFTC SKEGYRRRDK RVVNVKKHRK ETRTGCLAHM IITRQPDGKY  300
RVSHIEEQHN HENVNPSTAQ ALPPQRESSI SQAADAELVE GTKDFRTLSK FASESMNKRF  360
RLSEALDNVD IGYANHLQSE RTRDMKKGEV GSLLHYFQRQ HVENPSFFYA LQVDSDDKVC  420
NIFWADDKMV SDYDHFGDVV CLDTVCRTGK NCLPFVQFIG VNHHKQAMIF AAALLYDDTM  480
ESYKWLFQTF LEAMSGKKPK TILTDQDATI VEAINSVLSE TDHHICIWQM YENALKHISP  540
MVKDTESFAN DFKRCIYEHK DEDDFVSAWR DMLDNYDLHQ NDWLKWMFRA REKWAVVYGW  600
NTIFVDMEGG HLVESLFNDL RNYLHSDTTV LQFFKHFERV VDEQRSKERE ASDEMNRCLP  660
RLMGNVVMLK HAIRMGHCLS TEPKHMGQLE NTASHSVLLM IQLSAVVRNL SVGFLCSHAL  720
KVLDHRNIRV LPAKYVLKRW TKDARSGRAR LSDVSTVHDN PKLTVASRYK DLSHRILMLS  780
TRASESGEAF QYAARQLDQV LEGVEKILTL KPGDAQVVTS SSTGTTTFDI EYAENLLDEN  840
AFVNQGENGV KGENEQGSGV LDRAFTGNPI AQGLYTFEAS PANNCMYAQA NATLLQPPNI  900
FPNQHDSPSL LQLFQEPLIN GTYQEPVSEY VCGSPPFNCP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008234281.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_008234282.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLM5XT010.0M5XT01_PRUPE; Uncharacterized protein
STRINGGLYMA10G38320.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15090.19e-85FAR1 family protein